Kathy Y Wei, Ph.D.
@kathyywei.bsky.social
CSO & cofounder 310 AI, X-Baker Lab postdoc, Stanford PhD
Hey smart people out there, what structure does this protein fold into? Hint: AlphaFold, ESMFold, Boltz, Chai, etc are wrong 🤭. Good luck!
>whatami
MKIAVIGATGQVGREIAKLLAEKGHEVTAIASRSKNPEEVAKLGIEAVYVDGEVLDFKSVEEAVKNADVVISVAGG
>whatami
MKIAVIGATGQVGREIAKLLAEKGHEVTAIASRSKNPEEVAKLGIEAVYVDGEVLDFKSVEEAVKNADVVISVAGG
July 17, 2025 at 4:31 PM
Hey smart people out there, what structure does this protein fold into? Hint: AlphaFold, ESMFold, Boltz, Chai, etc are wrong 🤭. Good luck!
>whatami
MKIAVIGATGQVGREIAKLLAEKGHEVTAIASRSKNPEEVAKLGIEAVYVDGEVLDFKSVEEAVKNADVVISVAGG
>whatami
MKIAVIGATGQVGREIAKLLAEKGHEVTAIASRSKNPEEVAKLGIEAVYVDGEVLDFKSVEEAVKNADVVISVAGG
310 AI model MP4 designed 93 GLP-1R agonists. 67% outperformed the native peptide in experimental testing.
Surprisingly, the more creative the AI got, the greater the activity gains.
bit.ly/ai-glp1
Surprisingly, the more creative the AI got, the greater the activity gains.
bit.ly/ai-glp1
AI-Designed Peptides Outperform GLP-1 in Lab
67% of AI-designed peptides outperformed GLP-1 in binding assays vs. ~0.1% for traditional methods.
Peptides with 10+ changes delivered the biggest gains showcasing the power of AI creativity.
bit.ly
June 3, 2025 at 5:45 PM
310 AI model MP4 designed 93 GLP-1R agonists. 67% outperformed the native peptide in experimental testing.
Surprisingly, the more creative the AI got, the greater the activity gains.
bit.ly/ai-glp1
Surprisingly, the more creative the AI got, the greater the activity gains.
bit.ly/ai-glp1
Can citizen scientists design real drugs? Check out Drugit: www.nature.com/articles/s41...
Drugit: crowd-sourcing molecular design of non-peptidic VHL binders - Nature Communications
Citizen science taps the efforts of non-experts. Here, authors describe Drugit, an extension of the crowdsourcing game Foldit, and its use in designing a non-peptide binder of Von Hippel Lindau E3 lig...
www.nature.com
May 28, 2025 at 8:06 PM
Can citizen scientists design real drugs? Check out Drugit: www.nature.com/articles/s41...
Even in the era of AlphaFold, can't help but get super excited at a beautiful xtal 💠! Thanks Adaptyv Bio.
May 23, 2025 at 2:37 AM
Even in the era of AlphaFold, can't help but get super excited at a beautiful xtal 💠! Thanks Adaptyv Bio.
In our interview with Nature, we explore how AI is learning to design real, functional proteins at 310ai:
www.nature.com/articles/d41...
www.nature.com/articles/d41...
I told AI to make me a protein. Here’s what it came up with
A new crop of artificial-intelligence models allows users to create, manipulate and learn about biology using ordinary language.
www.nature.com
May 20, 2025 at 4:38 PM
In our interview with Nature, we explore how AI is learning to design real, functional proteins at 310ai:
www.nature.com/articles/d41...
www.nature.com/articles/d41...
MP4 uses AI to generate never before seen proteins from text that are validated in the lab. Learn more at the GEM workshop Apr 27 in Singapore at #ICLR2025.
www.biorxiv.org/content/10.1...
www.biorxiv.org/content/10.1...
March 27, 2025 at 4:11 PM
MP4 uses AI to generate never before seen proteins from text that are validated in the lab. Learn more at the GEM workshop Apr 27 in Singapore at #ICLR2025.
www.biorxiv.org/content/10.1...
www.biorxiv.org/content/10.1...
After obtaining the results of your research on Copilot, click the share button and export the 3D visualization of the hashtag#protein as an animated GIF.
March 20, 2025 at 5:19 PM
After obtaining the results of your research on Copilot, click the share button and export the 3D visualization of the hashtag#protein as an animated GIF.
#AF2BIND is a lightweight and efficient notebook designed for rapid inference on #AlphaFold2 outputs. After loading your protein into Copilot, click #FindPockets in the action box, and within seconds, the binding pockets will be displayed.
March 19, 2025 at 8:30 PM
#AF2BIND is a lightweight and efficient notebook designed for rapid inference on #AlphaFold2 outputs. After loading your protein into Copilot, click #FindPockets in the action box, and within seconds, the binding pockets will be displayed.
AI suggestions anticipate your next moves.
March 18, 2025 at 7:21 PM
AI suggestions anticipate your next moves.
Two clicks to a newly designed protein (using MP3).
March 17, 2025 at 5:21 PM
Two clicks to a newly designed protein (using MP3).
On 310 Copilot, you can open the Actions box and, by clicking the #FoldSeek button, quickly perform accurate and sensitive comparisons of large protein structure sets, supporting monomer and multimer searches.
March 14, 2025 at 4:31 PM
On 310 Copilot, you can open the Actions box and, by clicking the #FoldSeek button, quickly perform accurate and sensitive comparisons of large protein structure sets, supporting monomer and multimer searches.
Instantly visualize and design with just a click on the sequence.
March 13, 2025 at 5:46 PM
Instantly visualize and design with just a click on the sequence.
It's pretty hard to beat AI cat video cuteness, but here goes 😆
March 10, 2025 at 6:20 PM
It's pretty hard to beat AI cat video cuteness, but here goes 😆
If you're in the LA area, check out Tim's talk at Terasaki!
February 20, 2025 at 10:19 PM
If you're in the LA area, check out Tim's talk at Terasaki!
David Baker on "traveling light" 🤣
www.youtube.com/watch?v=1tEL...
www.youtube.com/watch?v=1tEL...
Nobel Minds 2024
YouTube video by Nobel Prize
www.youtube.com
January 17, 2025 at 2:29 AM
David Baker on "traveling light" 🤣
www.youtube.com/watch?v=1tEL...
www.youtube.com/watch?v=1tEL...
400 Presidential Early Career Award for Scientists and Engineers (PECASE) winners!
🏆 www.whitehouse.gov/ostp/news-up...
🏆 www.whitehouse.gov/ostp/news-up...
President Biden Honors Nearly 400 Federally Funded Early-Career Scientists | OSTP | The White House
Today, President Biden awarded nearly 400 scientists and engineers the Presidential Early Career Award for Scientists and Engineers (PECASE), the highest honor bestowed by the U.S. government on outst...
www.whitehouse.gov
January 17, 2025 at 2:13 AM
400 Presidential Early Career Award for Scientists and Engineers (PECASE) winners!
🏆 www.whitehouse.gov/ostp/news-up...
🏆 www.whitehouse.gov/ostp/news-up...
My brain by ChatGPT😜
2025: Year of Multi
Multi-modal: Protein AI that rolls with your mess—sequences, structures, affinities, whatever.
Multi-functional: Swiss Army AI—ask for anything, gets smarter every time.
Multi-specific: Chaotic toddler tamed. General when needed, sharp where it counts.
2025: Year of Multi
Multi-modal: Protein AI that rolls with your mess—sequences, structures, affinities, whatever.
Multi-functional: Swiss Army AI—ask for anything, gets smarter every time.
Multi-specific: Chaotic toddler tamed. General when needed, sharp where it counts.
January 7, 2025 at 10:16 PM
My brain by ChatGPT😜
2025: Year of Multi
Multi-modal: Protein AI that rolls with your mess—sequences, structures, affinities, whatever.
Multi-functional: Swiss Army AI—ask for anything, gets smarter every time.
Multi-specific: Chaotic toddler tamed. General when needed, sharp where it counts.
2025: Year of Multi
Multi-modal: Protein AI that rolls with your mess—sequences, structures, affinities, whatever.
Multi-functional: Swiss Army AI—ask for anything, gets smarter every time.
Multi-specific: Chaotic toddler tamed. General when needed, sharp where it counts.
Happy 2025! For everyone thinking about New Years goals, some smart person says to be a biologist 😎 .
www.instagram.com/reel/DEB-_4M...
www.instagram.com/reel/DEB-_4M...
Login • Instagram
Welcome back to Instagram. Sign in to check out what your friends, family & interests have been capturing & sharing around the world.
www.instagram.com
January 2, 2025 at 5:00 PM
Happy 2025! For everyone thinking about New Years goals, some smart person says to be a biologist 😎 .
www.instagram.com/reel/DEB-_4M...
www.instagram.com/reel/DEB-_4M...
Happy Holidays from the RosettaCommons. Read more: rosettacommons.org/2024/12/19/o...
December 24, 2024 at 11:07 PM
Happy Holidays from the RosettaCommons. Read more: rosettacommons.org/2024/12/19/o...
Reposted by Kathy Y Wei, Ph.D.
“Sculpting conducting nanopore size and shape through de novo protein design”
www.biorxiv.org/content/10.1...
github.com/vorobieva/de...
www.biorxiv.org/content/10.1...
github.com/vorobieva/de...
December 21, 2023 at 4:37 AM
“Sculpting conducting nanopore size and shape through de novo protein design”
www.biorxiv.org/content/10.1...
github.com/vorobieva/de...
www.biorxiv.org/content/10.1...
github.com/vorobieva/de...
Reposted by Kathy Y Wei, Ph.D.
Here goes the skeetorial for the latest preprint from our lab describing RFpeptides, a pipeline for design of target-binding macrocycles using diffusion models. Big shoutout to Stephen Rettie, David Juergens, Victor Adebomi for leading the project (1/n)
Preprint link: www.biorxiv.org/content/10.1...
Preprint link: www.biorxiv.org/content/10.1...
www.biorxiv.org
November 21, 2024 at 6:21 AM
Here goes the skeetorial for the latest preprint from our lab describing RFpeptides, a pipeline for design of target-binding macrocycles using diffusion models. Big shoutout to Stephen Rettie, David Juergens, Victor Adebomi for leading the project (1/n)
Preprint link: www.biorxiv.org/content/10.1...
Preprint link: www.biorxiv.org/content/10.1...
Reposted by Kathy Y Wei, Ph.D.
Excited to finally share Perceptein, a PERCEPtron made of proTEINs: www.science.org/doi/10.1126/...
A synthetic protein-level neural network in mammalian cells
Artificial neural networks provide a powerful paradigm for nonbiological information processing. To understand whether similar principles could enable computation within living cells, we combined de n...
www.science.org
December 13, 2024 at 1:41 PM
Excited to finally share Perceptein, a PERCEPtron made of proTEINs: www.science.org/doi/10.1126/...
Reposted by Kathy Y Wei, Ph.D.
Today, several #NobelPrize Laureates arrive in Stockholm, warmly welcomed by Hans Ellegren. Here we see David Baker stepping off the plane at Arlanda.
This week is packed with inspiration, press conferences and lectures, so stay tuned! 🌟
@uofwa.bsky.social @hhmi.bsky.social
#Science #AcademicSky
This week is packed with inspiration, press conferences and lectures, so stay tuned! 🌟
@uofwa.bsky.social @hhmi.bsky.social
#Science #AcademicSky
December 5, 2024 at 12:48 PM
Today, several #NobelPrize Laureates arrive in Stockholm, warmly welcomed by Hans Ellegren. Here we see David Baker stepping off the plane at Arlanda.
This week is packed with inspiration, press conferences and lectures, so stay tuned! 🌟
@uofwa.bsky.social @hhmi.bsky.social
#Science #AcademicSky
This week is packed with inspiration, press conferences and lectures, so stay tuned! 🌟
@uofwa.bsky.social @hhmi.bsky.social
#Science #AcademicSky
Reposted by Kathy Y Wei, Ph.D.
Our Big Fantastic Virus Database (BFVD) is now published NAR! It contains protein structure predictions of major viral clades, enhanced by petabase-scale homology search and it's explorable on the web.
🌐 bfvd.foldseek.com
💾 bfvd.steineggerlab.workers.dev
📄 academic.oup.com/nar/advance-...
🌐 bfvd.foldseek.com
💾 bfvd.steineggerlab.workers.dev
📄 academic.oup.com/nar/advance-...
November 23, 2024 at 9:12 PM
Our Big Fantastic Virus Database (BFVD) is now published NAR! It contains protein structure predictions of major viral clades, enhanced by petabase-scale homology search and it's explorable on the web.
🌐 bfvd.foldseek.com
💾 bfvd.steineggerlab.workers.dev
📄 academic.oup.com/nar/advance-...
🌐 bfvd.foldseek.com
💾 bfvd.steineggerlab.workers.dev
📄 academic.oup.com/nar/advance-...
Reposted by Kathy Y Wei, Ph.D.
Rosetta Community watching David get the award! @rosettacommons.bsky.social
December 10, 2024 at 3:45 PM
Rosetta Community watching David get the award! @rosettacommons.bsky.social