A hunk of space junk appears to have come in hot and heavy in Australia. On Saturday (Oct. 18), mine workers found a mysterious smoking slab sitting near a remote access road some 19 miles (30 kilometers) east of Newman, Western Australia. The Western Australia Police Force visited the site and took note of the incident, as did the Australian Space Agency, which explained that it will carry out "further technical analysis to identify its origin."

Centrist Rodrigo Paz wins Bolivian presidency, ending nearly 20 years of leftist rule

In a major legislative step to combat the growing misuse of artificial intelligence, South Korea has passed a bill criminalizing the possession or viewing of sexually explicit deepfake images and videos. Lawmakers approved the measure on September 26, 2024, following rising public concern over illegal content circulating on online platforms, particularly Telegram. The Scope of.

It’s finally here. Toyota has unveiled its new Land Cruiser FJ ahead of this year’s Japan Mobility Show. The highly anticipated baby off-roader is nearly 11 inches shorter than the Land Cruiser 250, giving buyers a smaller, more affordable option—except for those of us in America.   The new Land Cruiser FJ shares a platform with Toyota’s Hilux Champ, that's not available in the United States, and it’s about 11 inches shorter than the LC 250.

Analyst Report: State Street Corp.

OpenAI said Monday it would do more to stop users of its AI video generation app Sora from creating clips with the likenesses of actors and other celebrities after actor Bryan Cranston and the union representing film and TV actors raised concerns that deepfake videos were being made without the performers' consent. Actor Bryan Cranston, the Screen Actors Guild-American Federation of Television and Radio Artists (SAG-AFTRA) and several talent agencies said they struck a deal with the ChatGPT maker over the use of celebrities' likenesses in Sora.

  Discovery of a Novel Antithrombotic Cystine Knot Peptide from Spider Venom Gland Transcriptome Abstract The development of effective anticoagulants remains a critical need in modern medicine, particularly for preventing and treating thromboembolic disorders, such as arterial thrombosis and deep vein thrombosis (DVT), as well as complications like ischemic stroke. This study identifies a cysteine-knotted peptide GC38 (sequence: GCSGKGARCAPSKCCSGLSCGRHGGNMYKSCEWNWKTG) derived from the venom gland transcriptome of the Macrothele sp.

The previously announced Easygoing Territory Defense by the Optimistic Lord: Production Magic Turns a Nameless Village into the Strongest Fortified City anime revealed a new trailer featuring additional cast, the opening song, and a January 2026 premiere date. Easygoing Territory Defense by the Optimistic Lord – Trailer Rei Nakashima is singing the opening song “Okirakuze~shon,” and the cast includes: Yumi Uchiyama…

JSW Energy shares slipped over 5% to Rs 514.15 on the BSE in early trade on Monday after the company reported a 17% YoY decline in consolidated net profit to Rs 705 crore for Q2 FY26, compared with Rs 853 crore a year ago. Revenue from operations, however, rose 60% YoY to Rs 5,177 crore, driven by higher renewable capacity additions and contributions from the Mahanadi and O2 Power projects.

Microsoft has released PowerToys version 0.95.0, introducing several enhancements and a new feature focused on improving visual comfort. The main highlight of this update is the addition of Light Switch, a utility that automatically switches between light and dark themes based on the time of day. This automation uses the system clock to provide better visual comfort during extended computer use, reducing…

Japan has for the first time approved over-the-counter sales of an emergency contraceptive pill, its manufacturer says, allowing women in the country to take the medication without prescription. ASKA Pharmaceutical said wider access to the pill would "empower Japanese women in the area of reproductive health". A date for it to go on sale has yet to be announced. The pill will be labelled as "medicine requiring guidance", meaning women must take it in the presence of a pharmacist.

The first crewed moon landing in more than half a century may not be pulled off by SpaceX after all. In April 2021, NASA awarded Elon Musk's company a $2.9 billion contract to provide the first crewed lunar lander for the agency's Artemis program. That vehicle, a modified upper stage of SpaceX's Starship megarocket, is supposed to land astronauts on the moon for the first time on the upcoming Artemis 3 mission.

The second-generation Hyundai Venue has been spied completely undisguised on the streets of South Korea. These images were captured by Instagram user casper_i.vory, and published by The Korean Car Blog. For the new model, Hyundai has kept the basic silhouette, but there’s a new body with a modern design language. At the front, the Venue once again features a split headlight treatment, but this time the daytime running light graphic extends down into the main headlight unit.

Disney's Price Hikes Don't Make Sense For Its Shares

GP practices are facing a significant increase in workload as a result of consultations with patients requesting access to weight loss drugs when they are ineligible under current NHS guidelines. 
 
 by
 Kimberley Hackett

Duping a guppy is easier than duping a ring dove — at least when it comes to a classic optical illusion.   In the Ebbinghaus illusion, two identical circles placed side by side are each framed by a set of either smaller or larger circles. Human adults almost always perceive the circle ringed by smaller circles as the larger of the two options, previous research has shown.

Volkswagen Group Africa’s Kariega plant has achieved a major production milestone, rolling out 500,000 units of the current-generation Polo since the facelifted model entered production in August 2021. The landmark car — a striking Kings Red Polo headed for Germany — rolled off the line earlier this month. The Kariega facility has been the exclusive global production hub for the Polo since July 2024, supplying vehicles to over 30 countries across Europe and the Asia-Pacific region.

Barrons Roundtable discusses the importance of rare earths and magnets, and China’s monopoly over the industry. A major U.S. steelmaker is looking to help kickstart domestic production of rare earth minerals amid China's move to block access amid its trade dispute with the Trump administration. Cleveland-Cliffs, a steelmaker headquartered in Ohio, announced the rare earths plan on the company's quarterly earnings call on Monday.

Three new species of the genus Heteropoda (Araneae: Sparassidae: Heteropodinae) are described: Heteropoda curvata sp. nov. (♂, Sabah), Heteropoda flamma sp. nov. (♂, Hainan), and Heteropoda lucerna sp. nov. (♀, Guangxi Zhuang Autonomous Region). Detailed morphological descriptions, diagnostic illustrations, and a distribution map are provided for each species to facilitate identification and comparison with congeners. KORAI, S. K., & JÄGER, P. (2025). Descriptions of three new Heteropoda spiders from tropical Asia (Araneae: Sparassidae). European Journal of Taxonomy, 1022(1), 277-287.

IVE’s Wonyoung once again became the center of attention at W Korea’s “Love Your W” charity event. Fans and reporters were immediately captivated by her effortless beauty and elegant styling, which emphasized her natural charm and poise. The event showcased Wonyoung as a refined and confident idol, effortlessly standing out in a setting filled with.

A frequent perk of this job is the rolling out of heritage cars. Any carmaker with a respectful eye on its past has a collection of cars tucked away for special occasions or iconic anniversaries, Mercedes-Benz and Porsche boasting particularly envious collections near their German HQs. Right here in Britain, there’s an expanding collection of classic Bentleys in Crewe, a prime example of which you’re looking at here. 

US steps up diplomacy after Gaza truce shaken

Moe image gallery featuring drawings of anime girls as Alice in Wonderland outfit. Moe image gallery compilation of cute anime girls as Alice in Wonderland. Will you fall into the rabbit hole? Next time I will try to look for anime girls as the Cheshire cat. Omake image: Sakura Kinomoto as Alice. 

The Disk Pro redefines portable storage by integrating active cooling technology with a multi-port hub in a compact, high-performance device. Designed for professionals, gamers, and everyday users, it tackles common challenges such as overheating, limited connectivity, and slow data transfer speeds. With its thoughtful design and advanced features, the Disk Pro provides a seamless solution to meet the demands of modern digital workflows.

Introduction The postnatal period is defined in accordance with the WHO as beginning immediately after birth and extending through the first 6 weeks (42 days) following childbirth.1 This definition encompasses both the immediate postpartum phase (the first 24 hours after delivery) and the subsequent weeks up to day 42. This period is a critical window for supporting the health and well-being of both mothers and their newborns.